PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G25210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 711aa    MW: 74976.9 Da    PI: 7.3078
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G25210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.33.2e-08580623851
                      HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      +r   NR A r++R++Kka ++ Lee+v  L a N++L k+l++
  OPUNC06G25210.1 580 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQN 623
                      55566**********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF069113.1E-45273441IPR009686Senescence/spartin-associated
SMARTSM003384.5E-4571643IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.5E-11571623No hitNo description
PfamPF077164.3E-14575630IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-6577623No hitNo description
CDDcd146861.37E-10585630No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009644Biological Processresponse to high light intensity
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0005886Cellular Componentplasma membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MRERDPPPPT AWVPPVSVAT YAAGSPYTSA TSPASRRRLP HDSSSVPGGI NSSPRRAPMA  60
SYYYSSSSNP NPNASPAPSA PPLYPTLTMA DLAPVQIGPS SPMSPASPAT PVDADANVPP  120
PSEDVLLRIP GAQLHLIDRH RSYPLAAGDL SLLRIRSGDT SLAGIALLQP IQWPLARDVA  180
SVKLDPCHYS FSLTVPASAD DPNPDPLHYG LTLSHPDPRL DGILATYTSF SVQSVVGGEA  240
LASKVRDEVE AAAYWTAVAP NVEEYGGKVA NAIATGAGHL AKGILWCGEL TVDRLRWGNE  300
VLMKRMQPAD ADAEVSPEML RRIKRVKKVT KMSEKVATGI LSGVVKVTGY FTNSIANSKA  360
GKKFFNLLPG EIVLASLDGF GKICDAVEVA GTNVLSTSST VTTGLVSHKY GEKAAAATNE  420
GMDAAGHAIG TAWAVFKIRQ ALNPKSVLKP TSLAKSTIKA AAADFRAKQK KYHGCTATLP  480
AAMDDGDLDF SNPDTFLCPA VGGADPDGSC SMDSYFDDIL KDTEHHACTH THTCNPPVHD  540
LSHTHTCVHV HTKIVSAPSD TPSDAAETAE SPTENNASKK RPSGNRAAVR KYREKKKAHT  600
ASLEEEVVHL RALNQQLMKK LQNHAALEAE GSYLGGAQVM NSCDFRCADQ MYCSPGMPVK  660
TMGEDGAVSG QVLGQGACDI VSIQCTGAKS GSTKLPVCGA MGTMPVGFEK S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0714370.0AK071437.1 Oryza sativa Japonica Group cDNA clone:J023095M01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642504.10.0PREDICTED: uncharacterized protein LOC4342079
TrEMBLA0A0E0LFQ40.0A0A0E0LFQ4_ORYPU; Uncharacterized protein
STRINGLOC_Os06g50330.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-42bZIP family protein